Recovery
LL-37
Also known as: Cathelicidin LL-37 · hCAP18 (134-170)
Recovery & Repair In stock Box of 10 vials 1 reference
The only human cathelicidin — a 37-residue antimicrobial and immunomodulatory peptide.
Available sizes
| SKU | Per vial | Pack | |
|---|---|---|---|
| 375 | 5 mg | 10 vials / box |
Order LL-37
Pricing is quoted directly and is competitive at every tier — message us with the SKUs you want and quantities for a quote.
Replies within 36 hours. Cryptocurrency (preferred) or card / money-app with a processing fee. COA for this batch available on request.
LL-37 is the sole human member of the cathelicidin family of antimicrobial peptides, cleaved from the precursor hCAP18. It is an amphipathic α-helical peptide expressed by neutrophils, epithelial cells and keratinocytes.
Beyond direct broad-spectrum antimicrobial activity, LL-37 is characterised as a chemoattractant, an inducer of angiogenesis and a modulator of wound repair and innate immune signalling 1.
At a glance
- Human cathelicidin antimicrobial peptide
- Studied in wound healing, biofilm and innate-immunity models
- 5 mg vials
Research use only. All products are sold strictly for laboratory research and development purposes. They are not intended for human or veterinary use, diagnosis, treatment, cure or prevention of any disease. Not for human consumption. Summaries above describe published findings in laboratory and clinical research models and do not constitute claims about this product.
- Form
- Lyophilized powder
- Purity
- HPLC-verified — Certificate of Analysis available on request
- Pack size
- Box of 10 vials
- Storage
- Lyophilized: −20 °C, protected from light (2–8 °C short-term). Reconstituted: 2–8 °C.
- Sequence
- [LL-37, 37 aa]
- Formula
- C205H340N60O53
- Mol. weight
- 4493.3 g/mol
- CAS No.
- 154947-66-7
Sequence, formula and CAS data are provided for identification. Batch-specific purity, mass-spec and HPLC data are on the Certificate of Analysis — ask for it with your order.
- Dürr UH, Sudheendra US, Ramamoorthy A LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-25.
Citations retrieved from PubMed (NCBI). Links open the publisher record via DOI and the PubMed abstract.
Related
Often ordered together
Immune
Thymosin Alpha-1
Tα1 · Thymalfasin
28-residue thymic peptide and approved immunomodulator with a comprehensive clinical literature.
5 mg10 mg
Recovery